PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa09g088810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 515aa    MW: 58919.9 Da    PI: 10.2299
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa09g088810.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B340.64.6e-135781796
                    E--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3 17 vlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96
                    ++p  f+ ++ +g  e++kt +l++  s   W+vkl  ++k+    lt+GWkeF+ a++L+ gD+v+F+ +  ++  ++v++
  Csa09g088810.1  5 TIPVAFFLKYiKGRDEQKKTARLRSdASKIIWNVKL--DGKR----LTDGWKEFALAHNLRIGDIVIFRQE--RDLAFYVTL 78
                    6999999999977778999*****9677799*****..9999....***********************44..444446665 PP

2B372.45.5e-23115201490
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sef 90 
                     + + +++l+ + l +pk f++e+g ++ +s +++l++e+grsW++k++ + + g+++ ++GW +F++angLk+gD+v+Fkl++r +++
  Csa09g088810.1 115 ANVAPSSLRYDSLLFPKAFVRENGVVT-GSGEIVLMNEKGRSWTLKMKQKPSCGTIYVRGGWINFCDANGLKSGDTVTFKLIQRgRTR 201
                     567889999999***********9885.666****************99999999***************************973433 PP

3B370.42.4e-22261352497
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     + + +++l+ + ++lpkkf++e+g+ + ++ +++l++++grsW++ l+ +k  g++ +++GWk+F++angL +g +++Fkl++ ++++l+++++
  Csa09g088810.1 261 ASIAPSSLRYDTMYLPKKFMRENGIYT-KHGEIILMNQKGRSWTLDLKRKKWCGTFCIKRGWKSFCRANGLSAGSIITFKLIK-KRGTLTLRLI 352
                     5678899999*************8775.5569***************98888899**************************98.7777777765 PP

4B357.82e-18414511199
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy.rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                     f++ ++++++ + + l+lp +f++ +g++ke+  ++tl d++g++W+ kl   + ks+r  + +GWk+F +an +k+++++ ++l++++e+++v+
  Csa09g088810.1 414 FVTLTLTPYNVSASVLRLPIPFTRMNGIDKET--KMTLLDKQGKKWSTKLHLeDDKSKRLRMVGGWKGFLQANCVKANESIRLELIWEEEKSCVL 506
                     667778999999999***********999655..8***************778999999****************************99999999 PP

                     EEE-S CS
              B3  95 kvfrk 99 
                     k+++k
  Csa09g088810.1 507 KFRSK 511
                     99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086311.688182IPR003340B3 DNA binding domain
SMARTSM010192.2E-10282IPR003340B3 DNA binding domain
PfamPF023623.2E-8575IPR003340B3 DNA binding domain
SuperFamilySSF1019362.94E-13584IPR015300DNA-binding pseudobarrel domain
CDDcd100177.23E-9579No hitNo description
Gene3DG3DSA:2.40.330.106.6E-20696IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.9E-21106205IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.39E-20110211IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086315.961112209IPR003340B3 DNA binding domain
CDDcd100175.32E-20112206No hitNo description
SMARTSM010195.8E-27113209IPR003340B3 DNA binding domain
PfamPF023624.4E-21114202IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.6E-22250344IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.47E-21256355IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086315.65258355IPR003340B3 DNA binding domain
CDDcd100171.70E-21258353No hitNo description
SMARTSM010192.6E-26259355IPR003340B3 DNA binding domain
PfamPF023622.2E-21260352IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.5E-19406511IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.92E-19408509IPR015300DNA-binding pseudobarrel domain
CDDcd100176.94E-15413509No hitNo description
PROSITE profilePS5086313.324414511IPR003340B3 DNA binding domain
SMARTSM010199.1E-24414512IPR003340B3 DNA binding domain
PfamPF023621.0E-17414511IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MLVQTIPVAF FLKYIKGRDE QKKTARLRSD ASKIIWNVKL DGKRLTDGWK EFALAHNLRI  60
GDIVIFRQER DLAFYVTLLG PSCCEIRYGS CLEEETNLEK KKEKKSPNED SCFVANVAPS  120
SLRYDSLLFP KAFVRENGVV TGSGEIVLMN EKGRSWTLKM KQKPSCGTIY VRGGWINFCD  180
ANGLKSGDTV TFKLIQRGRT RVLRLLAKES KQEANDVSLS TEPESDEDSN IGKIQRQRKM  240
KKSPRRDTES SSSLDPSCFV ASIAPSSLRY DTMYLPKKFM RENGIYTKHG EIILMNQKGR  300
SWTLDLKRKK WCGTFCIKRG WKSFCRANGL SAGSIITFKL IKKRGTLTLR LIPNEGEEEE  360
EISEANKVES LSRDQESDEE SSHDEKISQE CSRRNEKKRR LRWIASSSPS KNRFVTLTLT  420
PYNVSASVLR LPIPFTRMNG IDKETKMTLL DKQGKKWSTK LHLEDDKSKR LRMVGGWKGF  480
LQANCVKANE SIRLELIWEE EKSCVLKFRS KVNL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010429446.10.0PREDICTED: B3 domain-containing protein REM14-like
SwissprotO230760.0REM15_ARATH; Putative B3 domain-containing protein REM15
TrEMBLR0FW440.0R0FW44_9BRAS; Uncharacterized protein (Fragment)
TrEMBLD7LIB20.0D7LIB2_ARALL; Transcriptional factor B3 family protein
STRINGAT4G00260.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.10.0B3 family protein